PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G251700.2
Common NamePOPTR_0005s27310g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 876aa    MW: 96937.4 Da    PI: 6.3221
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G251700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.53.1e-29569619252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Potri.005G251700.2 569 EKTITLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGINRWPSRKIKKV 619
                         79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.552558639IPR003035RWP-RK domain
PfamPF020422.9E-25571619IPR003035RWP-RK domain
SuperFamilySSF542775.33E-22779871No hitNo description
SMARTSM006668.3E-23789872IPR000270PB1 domain
PROSITE profilePS5174524.801789872IPR000270PB1 domain
PfamPF005644.3E-17790871IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.1E-22790869No hitNo description
CDDcd064072.35E-37790869No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 876 aa     Download sequence    Send to blast
MMEDGVLSPG MMLGAAVDSA MDFDYMDELL LEGCWVETTD GSEFLNPTSS LSQKGSQEVS  60
HIPLLPGNSP SDIQSRSPVG EIAVSAAGWE YNATEGSELG KRWWIGPAPN PSPGTTVKRR  120
LIKAVECIKD LTKNKDVLIQ IWVPVNRGGR RVLTTHDQPF ALDPSSERLA SYRDISVKYQ  180
FSAEKDSKDS VGMPGRVFLG KVPEWTPDVR FFRNDEYPRV NHAQQCDVRG TLALPVFEQG  240
SRTCLGVIEV VTTSQKIKYL PELESVCKAL EACDMSYQAA LPEIQKVLRA ACETHRLPLA  300
QTWVPCIQQG KGGCRHSNEN YYHCVSTVDD ACCVGDPAFQ GFLEACSEHH LLKGQGVVGE  360
AFMTNQPCFS GDVTLYGKTE YPLSHHARIF GLCAAVAIRL RSMYTGTTDF VLEFFLPVDC  420
RDPQEQKTML TSLSIIIQRV CQTLRVVTVK ELEEETDLPV SEVLVPSDGR SSGEETSTVK  480
ESYSERNARD NSPWTACLLK VQQSESNASL SEKDKEKVMC EKSFESRHNQ EDYSLRGSTK  540
YGGDSTSAEG SFSSVCKTKP GEKRRAKTEK TITLQVLRQY FAGSLKDAAK SIGVCPTTLK  600
RICRQHGINR WPSRKIKKVS HSLQKLQCVI DSVEGAPGSV QIGSFYENFP ELASPNSSRN  660
SSLSTLNPSS HPKPSGIQLE GGTFSSHVAE PKSPSPSCSL SSSSSHSYSS TTQQYPSAIT  720
VSASEDPKLG ENLGSGVLKK IRSNAELHAS ILEERKLMLR SQSHTTLTEL GNRPPLPKDS  780
SRLSQEMDGH RVKVSFRNDK IRLRMPNNWV FKDLLQEIIR RFNLDDMHRY DLKYLDDDSE  840
WVLLACDDDL EECIDVCGSG DNQTIKLLIE VSPHP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306977.20.0NIN-like protein 1
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLB9H5I10.0B9H5I1_POPTR; NIN-like protein 1
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein